PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G058900.1.p
Common NameSb04g004940, SORBIDRAFT_04g004940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 338aa    MW: 36775 Da    PI: 9.0139
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G058900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.36.9e-4163140178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +CqvegC  dl+++k+yhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  Sobic.004G058900.1.p  63 RCQVEGCGLDLTRVKDYHRKHRVCEAHTKSPRVIVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 140
                           6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-3457125IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.41961138IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-3962143IPR004333Transcription factor, SBP-box
PfamPF031103.9E-3164137IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEWTAPKPAS SPSSPPLLWD WGDHAATGSG SSSGDAPARR GAGKEREAKR ARGEDGGGGA  60
EVRCQVEGCG LDLTRVKDYH RKHRVCEAHT KSPRVIVAGQ ERRFCQQCSR FHALSEFDQK  120
KRSCRRRLSD HNARRRKPQP DAFTFASARL PSSLFDDRRQ ISFVWNKAPV SHVRPFTSPW  180
DSSSDLKLPH AKETREVSTK VGTITGQVHL DKSHMSNAIP TLSHGKDEPW PMKGPDMSIT  240
ASKFDGAPDL QRALSLLSVG ACGLPDPVHQ TSCVIQFTGA SENSGDLHLS HGGNSGPASC  300
ADGQHIAAQS QSQLVRFTMD TSNNVYEPSF FGVNQIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2653137184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1119136KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0334150.0BT033415.1 Zea mays full-length cDNA clone ZM_BFb0223G18 mRNA, complete cds.
GenBankBT0875080.0BT087508.1 Zea mays full-length cDNA clone ZM_BFb0098L17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451633.10.0hypothetical protein SORBIDRAFT_04g004940
SwissprotQ653Z53e-98SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLC5XW640.0C5XW64_SORBI; Putative uncharacterized protein Sb04g004940
STRINGSb04g004940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-44squamosa promoter binding protein-like 2